SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150PNW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150PNW8
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily AF1862-like 3.66e-27
Family Cas Cmr5-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150PNW8
Sequence length 129
Comment (tr|A0A150PNW8|A0A150PNW8_SORCE) Uncharacterized protein {ECO:0000313|EMBL:KYF57431.1} KW=Complete proteome OX=56 OS=Sorangium cellulosum (Polyangium cellulosum). GN=BE08_43515 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MDQQRALLAHKHVSEVKKWPDEKLRKKYGGMVHRLPALVRSAGLSQALHFVSSRKSDDQK
RVLDHLAAQLGHIDARIQSREALLEVVRGAPLPKYLVLTREVLACVDWYRRLVQGELGIE
AGEQDDDSD
Download sequence
Identical sequences A0A150PNW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]