SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150QSV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150QSV5
Domain Number 1 Region: 69-145
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.000000000213
Family Crystallins/Ca-binding development proteins 0.013
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.0000839
Family Crystallins/Ca-binding development proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150QSV5
Sequence length 150
Comment (tr|A0A150QSV5|A0A150QSV5_SORCE) Uncharacterized protein {ECO:0000313|EMBL:KYF71071.1} KW=Complete proteome OX=56 OS=Sorangium cellulosum (Polyangium cellulosum). GN=BE17_19015 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MPDRASSIRVPAGLRVTAFFNANFEEGAYVFTSDTNLVTAGTNGVSVSANDIISSIVVSP
ASDPQLDVVTFYEHANFSGQSFVYSVGGNFLFNGPWDWRISSVRVPPGFKLTLYDGYVWF
SQESRVFTADANLAPHGFDDKTRSFLIERL
Download sequence
Identical sequences A0A150QSV5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]