SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A150SG50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A150SG50
Domain Number 1 Region: 23-99
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000000205
Family Crystallins/Ca-binding development proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150SG50
Sequence length 104
Comment (tr|A0A150SG50|A0A150SG50_SORCE) Uncharacterized protein {ECO:0000313|EMBL:KYF91330.1} KW=Complete proteome OX=56 OS=Sorangium cellulosum (Polyangium cellulosum). GN=BE20_15120 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MSADEIISSIVVAHASDPQLDVVTFYENANFSGQSFVYSVGGNFFFNGPWDFRVSSVRVP
PGFKLTLYDGYFWTSPESRVFTADANLAPHGFDDKARSFIIERL
Download sequence
Identical sequences A0A150SG50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]