SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151GEA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151GEA1
Domain Number 1 Region: 31-303
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-81
Family Capz beta-1 subunit 0.0000000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151GEA1
Sequence length 311
Comment (tr|A0A151GEA1|A0A151GEA1_9HYPO) F-actin capping protein beta subunit {ECO:0000313|EMBL:KYK55403.1} KW=Complete proteome; Reference proteome OX=98403 OS=Drechmeria coniospora. GN=DCS_07366 OC=Drechmeria.
Sequence
MYEPLPIQPHTPTSSSSNDVHVQTDIDPRTSDLLRRLNPKHTSDHVNGIISLAPDLTEDL
LSSVDQPLTIQRCKQTGRDYLLCDYNRDGDSYRSPWSNQFDPPLDEGGVGGVGADGNEGA
GEGAIPSERVRKMEVKANEAFDVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSAPPGGT
SSGVWDSIHVFEAIERGRTTHYKLTSTVILSLATAEGGVGDMDLSGNMTRQLEQDLPVES
DESHIANVGRLVEDMELKMRNLLQDVYFGKAKDVVGDLRSIGSLSEGARDRETQRGIIGS
MKRSEGAEANA
Download sequence
Identical sequences A0A151GEA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]