SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151L3C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151L3C1
Domain Number 1 Region: 4-231
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-42
Family Capz beta-1 subunit 0.0000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151L3C1
Sequence length 259
Comment (tr|A0A151L3C1|A0A151L3C1_PLARE) F-actin capping protein beta subunit, putative {ECO:0000313|EMBL:KYN93441.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRSY57_0008300 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
KEGSIKINYDKEENKYYLGNMFNKEKDSYRSPYTNIYFPEHYINSYVPPEHLRTLEILYN
NIFDRYRKAYYMNGLSSVYLWPNPIEDGFVACFLIKKEEIFDKETNIEWEATHLIQVNIR
NLNVYYQISCTINFEIKKYNDNLLLSGNINKALENSKKVTDLYLIKDQYFHMENMGYLIE
CMENSLRKSIEYIYILKIQDMLNSIKHYNFTNHLTYNNSNKNISNISNSLIFSREYIQKE
LQTKIKQVRKKKKEKKSIF
Download sequence
Identical sequences A0A151L3C1
XP_012761689.2.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]