SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151MKE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151MKE7
Domain Number 1 Region: 275-474
Classification Level Classification E-value
Superfamily MIR domain 1.31e-69
Family MIR domain 0.00000000523
Further Details:      
 
Domain Number 2 Region: 476-641
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.36e-60
Family IP3 receptor type 1 binding core, domain 2 0.0000000215
Further Details:      
 
Domain Number 3 Region: 147-259
Classification Level Classification E-value
Superfamily MIR domain 1.44e-20
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151MKE7
Sequence length 1088
Comment (tr|A0A151MKE7|A0A151MKE7_ALLMI) Uncharacterized protein {ECO:0000313|EMBL:KYO24933.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0023796 OC=Alligator.
Sequence
MKPRVSRENGLRVNRCCRKNRRPDARVVQRSATRASKPEMTDKMSSFLHIGDICSLYAEG
STNGFISTLGLVDDRCVVQPDAGDLNNPPKKFRDCLFKLCPMNRYSAQKQFWKAAKPGAN
STTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPAL
LEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNAGQPLHASSHQLV
DNPGCNEVNSVNCTTSWKIVLFMKWSDNKDDILKGGDVVRLFHAEQEKFLTCDEHRKKQH
VFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVNPD
YEEDGQECQSSLDPDQDGSQQGLHNAQEKMAYSLVSVPEGNDISSIFELDPTTLRGGDSL
VPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPVSPAEVR
DLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVLEVVFSK
PNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELGDQRHAPFRHICRLCYRVLR
HSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSL
VRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPANADILIETKLVLSRFEFEGVS
SGDNALEVGEDEEEVWLFWRDSNQEIRSKSIRELAQDAKEGQKEDRDVLSYYRYQLNLFA
RMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQEQVTPV
KYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVCQRFPFSDKEKNK
LTFEVVNLARNLIYFGFYNFCDLLRLTKILLAILDCVHITTIFPITKMAKGEENKGSNVM
RSIHGVGELMTQVVLRGGGFLPIAPLAAAPEGNVKQSEPEKEDILVMDTKLKIIEILQFI
LNVRLDYRISCLLCIFKREFDESNAQMSESPTGSSSPDVPTNVPGALDFEHIEEQAEGIF
GGRKVSFQ
Download sequence
Identical sequences A0A151MKE7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]