SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151NCS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151NCS7
Domain Number 1 Region: 26-201
Classification Level Classification E-value
Superfamily MIR domain 6.02e-62
Family MIR domain 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151NCS7
Sequence length 218
Comment (tr|A0A151NCS7|A0A151NCS7_ALLMI) Stromal cell-derived factor 2 {ECO:0000313|EMBL:KYO34419.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0019037 OC=Alligator.
Sequence
MRLLLLAELALGLALGLGAAAAGGGSEPDAVTCGSVVKLLNVRHNVRLHSHDVRYGSGSG
QQSVTGVSAVDDSNSYWRIRGKTSTVCGRGTPVKCGQSIRLTHINTGRNLHSHHFTSPLS
GNQEVSAFGEDGEGDYLDDWTVVCSGPYWARDSEVRFKHSSTDVFLSVTGEQYGRPIHGQ
KEVHGMSYSNQNNYWKVMEGIFMKPSELLRMDPYHSEL
Download sequence
Identical sequences A0A151NCS7
XP_014449958.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]