SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151NIR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151NIR1
Domain Number 1 Region: 25-290
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-80
Family Capz alpha-1 subunit 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151NIR1
Sequence length 303
Comment (tr|A0A151NIR1|A0A151NIR1_ALLMI) F-actin-capping protein subunit alpha-3 {ECO:0000313|EMBL:KYO36677.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0024351 OC=Alligator.
Sequence
MEPFFEKLQYYRSKTMSKECDLHKKEKVSTICNLLYQAPPGEFSNVFEDLRTLVQDDELM
REEVAQVCAHHNKNNFTTVRIEGRNILVTRYNDLGGNRFFDPQNKFSFKFDHLSETTSKF
QLHGVLLDETELWRRALNSALKAYVSSYFPSGDCSVFRKTLKNRQIFVVCIVGHEYKALG
FWNTTWKSEWTFALSPVITQVTGIYHLQIHYFNYANLHMTVSKTTEEVLHVIDQAQLAMD
FVKLIKAEDNNFQVALIENLQALSEETWGKTVRRRLPVTNTVMNWNTLLTNQNLGTSVSK
CRI
Download sequence
Identical sequences A0A151NIR1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]