SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151P002 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151P002
Domain Number 1 Region: 69-118
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000144
Family Elafin-like 0.00071
Further Details:      
 
Domain Number 2 Region: 22-68
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000301
Family Elafin-like 0.00047
Further Details:      
 
Domain Number 3 Region: 121-166
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000262
Family Elafin-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151P002
Sequence length 211
Comment (tr|A0A151P002|A0A151P002_ALLMI) Antileukoproteinase isoform B {ECO:0000313|EMBL:KYO42169.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0002795 OC=Alligator.
Sequence
MGLLAFWTALLSTCSPALQDPPLKVKPGTCPEITKTCKMENPPNLCHHDSQCPGAQKCCA
TSCGLGCVPVHDVKPGICPEIEMRCLMLNPKNDCDTDSECSGSMKCCTSFCGRKCLDPRD
EKPGTCPPINKKCHSLNPPNSCTQDNDCSASMKCCYTGCGLHCVEPCNVTHPSSSTGQEH
PQKPTDCGSLQPHRTESPPSHTQKPPHIPPA
Download sequence
Identical sequences A0A151P002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]