SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151S0H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151S0H1
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 0.00000000000000445
Family Cytochrome f, large domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151S0H1
Sequence length 57
Comment (tr|A0A151S0H1|A0A151S0H1_CAJCA) Apocytochrome f {ECO:0000313|EMBL:KYP48300.1} KW=Complete proteome; Reference proteome OX=3821 OS=Cajanus cajan (Pigeon pea) (Cajanus indicus). GN=KK1_029992 OC=Phaseoleae; Cajanus.
Sequence
EAIGRIVYATCHLANKLVDIDVLQVVLPNIIFKVVALIPYDMQVKQVLDNDKTFQKN
Download sequence
Identical sequences A0A151S0H1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]