SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151TW15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151TW15
Domain Number 1 Region: 10-294
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-78
Family Capz alpha-1 subunit 0.00000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151TW15
Sequence length 305
Comment (tr|A0A151TW15|A0A151TW15_CAJCA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KYP71201.1} KW=Complete proteome; Reference proteome OX=3821 OS=Cajanus cajan (Pigeon pea) (Cajanus indicus). GN=KK1_010450 OC=Phaseoleae; Cajanus.
Sequence
MAEEEEESELSDKQKVEIAKWFLLNSPPGEIQYVAKDVKSILNNDDLYNEAASEAFPVYN
KFHLISLPMSNRSGDVLVNSFGELEGNAFLEPRTAQVAIVDHVKQACTEVRPATDEELPS
PYTEEFRCNLDAEILKYVEEAYPKGVCSVYCTSGKDVEGPGSDFELAVVISAARHSPQNF
CNGSWCSIWNIEFRDDQQTVEVKGKLQVGAHYFEEGNVQLDAKHECKDATLFQAPEDCAV
AITSIIRHHETEYLASLEASYLKLPDSTFKDLRRKLPVTRTLFPWHNTLQFSLTRDISKE
LGIGK
Download sequence
Identical sequences A0A151TW15
XP_020213984.1.88050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]