SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151UH48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151UH48
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-45
Family Capz beta-1 subunit 0.00000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151UH48
Sequence length 137
Comment (tr|A0A151UH48|A0A151UH48_CAJCA) Putative F-actin-capping protein subunit beta {ECO:0000313|EMBL:KYP78609.1} KW=Complete proteome; Reference proteome OX=3821 OS=Cajanus cajan (Pigeon pea) (Cajanus indicus). GN=KK1_049834 OC=Phaseoleae; Cajanus.
Sequence
MEAAMGLMRRIPPKHTETALSALLSLMPHHSPDLLSQVDQPLQVLCDVECGKQFILCEYN
RDADSYRSPWSNKYHPPLEDGSLPSSALRKLEIEANDIFAIYRDQYYEGGISSVYMWEDD
NEGFVACFLIKKGEAFI
Download sequence
Identical sequences A0A151UH48
XP_020209597.1.88050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]