SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151ULX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151ULX7
Domain Number 1 Region: 28-128
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 9.29e-19
Family DNA polymerase III psi subunit 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151ULX7
Sequence length 146
Comment (tr|A0A151ULX7|A0A151ULX7_9GAMM) DNA polymerase III subunit psi {ECO:0000256|PIRNR:PIRNR029225} KW=Complete proteome; Reference proteome OX=1462730 OS=Sodalis-like endosymbiont of Proechinophthirus fluctus. GN=BG74_01260 OC=Pectobacteriaceae; Sodalis.
Sequence
MRTRRDWLLQQLGITQWTLRRPAVLRGEVAVTLPGRIRLLLVAEAPPPLDHPLVVDVALS
MTLTPAQLYGVTPLQVMMLSDNVRCHCWWLGLEALRDFEGMSSFHTPLLEALSRDADAKR
ELWRRISDDEYYITAAAGRSHHSLTH
Download sequence
Identical sequences A0A151ULX7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]