SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151VUW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151VUW5
Domain Number 1 Region: 4-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-77
Family Capz alpha-1 subunit 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151VUW5
Sequence length 309
Comment (tr|A0A151VUW5|A0A151VUW5_HYPMA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KYQ39455.1} KW=Complete proteome; Reference proteome OX=39966 OS=Hypsizygus marmoreus (White beech mushroom) (Agaricus marmoreus). GN=Hypma_06641 OC=Hypsizygus.
Sequence
MDATERIQAASNFLLQSPPGEINDVLNDVRNIISDDDLLQEGVLPALREYNLAQFMTVDV
PGTEHQSIVSEAARISSSESGSEERFLDPRSKTSFVFDHLSLEASDPQTVEPSSESEPFR
LALETSTLTYLSAHFHDGVASVFSTQETPNRFVIQVVANKYNPTNYWAGRWRSEYFVDLN
ENKVSGKILVNIHYYEQGNVQLATTHEISLALPPAVVTSSPSSSASKIIALIGDEEGKYQ
ISLNDTYQEMGEKTFKGLRRALPMTRQKIDWDKVNCFFRDRWTFPVLTYREGPRIQAGSR
IKLKQGSLW
Download sequence
Identical sequences A0A151VUW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]