SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151XIQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151XIQ7
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-97
Family Capz beta-1 subunit 0.00000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151XIQ7
Sequence length 268
Comment (tr|A0A151XIQ7|A0A151XIQ7_9HYME) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KYQ60303.1} KW=Complete proteome; Reference proteome OX=64791 OS=Trachymyrmex zeteki. GN=ALC60_00711 OC=Vespoidea; Formicidae; Myrmicinae; Trachymyrmex.
Sequence
MDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAKDKESGKDYLLCDYN
RDGDSYRSPWSNTYDPPLEDGSMPSERLRKLEIDANHAFDQYRELYFEGGVSSVYLWDLD
HGFAAVILIKKAGDGSKKIKGCWDSIHVVEVQEKSTGRTAHYKLTSTAMLWLQTNKHGSG
TMNLGGSLTRQVEQDAQISETSPHIANIGRMVEDMENKIRNTLNEIYFGKTKDIVNGLRS
VQSLADQRQQAALRQDLAAALQRRNANN
Download sequence
Identical sequences A0A151XIQ7 A0A158NEM1 A0A195BUV7 A0A195EN29 E2BT35 F4WRT9
Hsal_05708--XP_393085.2_APIME XP_011058517.1.86870 XP_011058519.1.86870 XP_011058520.1.86870 XP_011058521.1.86870 XP_011638445.1.19355 XP_011688524.1.89273 XP_011688525.1.89273 XP_011882905.1.68811 XP_012055979.1.45171 XP_012543528.1.53737 XP_018053009.1.4000 XP_018053018.1.4000 XP_018053026.1.4000 XP_018053035.1.4000 XP_018305297.1.62676 XP_018305305.1.62676 XP_018305311.1.62676 XP_018365273.1.32933 XP_018365282.1.32933 Aech_05587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]