SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A151YRZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A151YRZ5
Domain Number - Region: 3-97
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.0085
Further Details:      
 
Domain Number - Region: 95-163
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.0942
Family ERP29 C domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151YRZ5
Sequence length 186
Comment (tr|A0A151YRZ5|A0A151YRZ5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KYQ81046.1} KW=Complete proteome OX=1785128 OS=Acinetobacter lactucae. GN=AWW73_15185 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MLEQLQRLQAHISVLKTRLHHLESEHAALSEAKELAETEHHAQVVQKNSIITKKQEEIET
VTEQLSQLKGQFQQLNQDANTLAERYSRLEKSTTDLKNRFQEILAERNELRVAKEKLQAH
QRQTQQELHDLQQDRDRLLQKNELAKSKVEAIIQRLGILGTAQDQHAQEIQQLAHPNAET
GEETQS
Download sequence
Identical sequences A0A0Q2APY5 A0A151YRZ5 R8Z2G2
WP_016144663.1.28266 WP_016144663.1.29121 WP_016144663.1.34452 WP_016144663.1.54304 WP_016144663.1.62636 WP_016144663.1.75432 WP_016144663.1.76198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]