SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A152A7H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A152A7H1
Domain Number 1 Region: 22-201
Classification Level Classification E-value
Superfamily NAP-like 4.97e-25
Family NAP-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A152A7H1
Sequence length 244
Comment (tr|A0A152A7H1|A0A152A7H1_9MYCE) Nucleosome assembly family protein {ECO:0000313|EMBL:KYR02158.1} KW=Complete proteome; Reference proteome OX=361077 OS=Tieghemostelium lacteum. GN=DLAC_00962 OC=Raperosteliaceae; Tieghemostelium.
Sequence
MSKKVKSKEQAATTTESNDKSEVISEALLKQAIDIQSQIEKIYEDNKIKVLEIEKKYQEK
LKPHYEKRDKLIETSKGLDNFWSQAISKAMIDNFDTLDQEVCDAITLMEVKVDINTQDGS
QKKTLTLHFKDNSVFSNKTLSKTIQFKNDGQYTSESDKVQYKSQPDTKKNNNNNKNQKKR
KELEKESFLLKFIEFNEDPESFVDIFEDLLKIYEDPFSMVLDDDEDDDEEFDEDADEGDS
NDDN
Download sequence
Identical sequences A0A152A7H1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]