SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A154VG04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A154VG04
Domain Number - Region: 17-99
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00183
Family Apolipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A154VG04
Sequence length 111
Comment (tr|A0A154VG04|A0A154VG04_9PROT) Uncharacterized protein {ECO:0000313|EMBL:KZD00240.1} KW=Complete proteome OX=501868 OS=Thalassospira sp. MCCC 1A02898. GN=AUQ41_06525 OC=Rhodospirillaceae; Thalassospira.
Sequence
MSPEQYKPDQFKNDLKRVLSLIRTGQRYLEDGKVVELAALESRIADLCEKARTMAPDQRQ
DVAPLLAALSEELAEFETRMQQEYSDIQRQLRGISNTAQATNAYAQAARTK
Download sequence
Identical sequences A0A136HMG9 A0A154VG04 A0A199Y2U2 A0A199YKW0 A0A2E4LTQ5 K2LHK8
WP_008890385.1.40157 WP_008890385.1.46728 WP_008890385.1.598 WP_008890385.1.69090 WP_008890385.1.98970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]