SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A157UF70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A157UF70
Domain Number 1 Region: 4-58
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000000000147
Family H-NS histone-like proteins 0.001
Further Details:      
 
Domain Number 2 Region: 91-133
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000549
Family H-NS histone-like proteins 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A157UF70
Sequence length 133
Comment (tr|A0A157UF70|A0A157UF70_ENTCL) DNA-binding protein {ECO:0000256|PIRNR:PIRNR002096} KW=Complete proteome OX=550 OS=Enterobacter cloacae. GN=SAMEA2273283_02327 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MSFMLQKLNNIRSLRAMAREFSTDVLEEMLEKLRIVTEEKRAEQQKTQQQQAEYQEKINT
WLELMVADGISPDELVLHEMAPAKSSKKRKPRPAKYRYTDHTGAEKTWTGQGRMPKPIAL
AVAQGKSLESFLI
Download sequence
Identical sequences A0A0F0YYE4 A0A157UF70
WP_032706443.1.11757 WP_032706443.1.45343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]