SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A158JZ24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158JZ24
Domain Number 1 Region: 88-180
Classification Level Classification E-value
Superfamily Barstar-related 1.01e-22
Family Barstar-related 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A158JZ24
Sequence length 187
Comment (tr|A0A158JZ24|A0A158JZ24_9BURK) Barstar family protein {ECO:0000313|EMBL:SAL74152.1} KW=Complete proteome OX=1777132 OS=Caballeronia peredens. GN=AWB71_04788 OC=Burkholderiaceae; Caballeronia.
Sequence
MSDNIYAHDHSVANDLFATGDGNLFQRVLRLRMTEHDTRPDDETRPEESHSHEETESMFA
TVRPNIVQSIRAFRVQDLADEANRLGQHFLYAYLGHAQSKQEVLETIATSFLFPKHFGKN
YDALYDSLTDLVHKAGSQPGFVIVLEQLPIAQKFDKEGREVLLDVFRDAAEFWAERRVAF
RVFYSFV
Download sequence
Identical sequences A0A158JZ24
WP_087126395.1.97357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]