SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A158NQV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158NQV4
Domain Number 1 Region: 155-338
Classification Level Classification E-value
Superfamily MIR domain 8.72e-60
Family MIR domain 0.00000011
Further Details:      
 
Domain Number 2 Region: 339-513
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.55e-50
Family IP3 receptor type 1 binding core, domain 2 0.000000517
Further Details:      
 
Domain Number 3 Region: 1036-1064,1098-1210
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.48e-36
Family IP3 receptor type 1 binding core, domain 2 0.0071
Further Details:      
 
Domain Number 4 Region: 40-133
Classification Level Classification E-value
Superfamily MIR domain 0.0000000191
Family MIR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A158NQV4
Sequence length 2646
Comment (tr|A0A158NQV4|A0A158NQV4_ATTCE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:XP_012059912.1} KW=Complete proteome; Reference proteome OX=12957 OS=Atta cephalotes (Leafcutter ant). GN=105623125 OC=Vespoidea; Formicidae; Myrmicinae; Atta.
Sequence
MGELLGSASFLHLGDIVSLYAEGNVSGFLSTLGLIEKKSLLHLKSNKFLTVNKRLPALLE
KNAMRVYLDANGNEGSWFYIMPFYKLRSDGDSVVVGDKVIMEPVNAGRQGLHVAANYELS
DNPGCKEVNVVNSSTSWKVTLFMEHRENQEEILKGGDVVRLFHAEQEKFLTMDEYKKKQH
VFLRTTGRTSATAATSSKALWEVEVVQHDPCRGGAGHWNSLFRFKHLATGQYLAAEVDTD
EPRESVKGKHPPGPVYRLVSVPHSNEISSLFELDPTTLTRGDSLVPQSSFVRLHHICTNT
WVHSTSVPIDKDDEKPVMSKVGCATSKEDKEAFALRSVSPVEVRDLDFANDACKVLTAMN
SKLEKGTISHNERRAVTSLLQDIVYFIAGSENEQNKSEALELVVTNVKDGPVRDRQKLLR
EQYILGQLFKILQAPFLESVEGEGPFLRIEELNDPRHAPYKYMFRLCYRILRLSQQDYRK
NQEYIAKHFAFMQKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMRNW
QSRFLDYLSDLCISNKKAIAVTQELICKSVLSEKNKDILIGTKMVKTQVEVEDIDEKQEN
AEPKITVIEEFEVVLEWNSGAKSMSLSELSRGAKMGNVQDAAILDYYRHQLNLFSNMCLN
RQYLALNNLSLHLDIDLILKCMEDETVPYELRASFCRLMLHLHVDRDPQEQVTPVKYARL
WSEIPPKMSINDYDTNKMPDQNKEAVRTKFSSTIMFVEDYLCNVVAKMWSFGDQEQNKLT
FEVVKLARDLIYFGFYSFNDLLSLTKTLLSILDCVSENESTDGKIPTGDIDCKLVDDRSE
GGILRCIGDMGAVMTNLTLGPAGQVLASSSPRPKPLMKKEYPLVMDTKLKIIEILQFILD
VRLDYRISCLLSIFKREFDETALTAAEKTGDVTLGQKAIDLDSISAQAEGIFGSSEECAA
LDLDGQGGRTFLRVLLHLAMHDYPPLVSGALHLLFRHFSQRQEVLQAFKQVQLLVSDSDV
ESYKQIKADLDILRQSVEKSELWVYKSKATEEHGNKKKKSKEEEDEATAPRKIPLLSALD
KQGSAIDLDIGPPLHSDQTEEYKKIQQILMRMNKLCIQNLPGGQVKARKHEQRLLRNVGV
HTVVLDLLQVPYDTKEDVRMNELMRLAHDFLQNFCLSNQQNQVLLHKQLDLFLNPGIREA
QTICSIFQDNSVLCNEVGAKVIQHFVHCIETHGKHVQYLKFLQTIVKAENQFIRKCQEMV
MQELVQAGEDVLVFYNDRASFNHFVEMMRSERHRMDESSPLQYHVELVKLLACCTMGKNV
NTEIKCHSLLPLDDIVAVVSHPDCIPEVKEAYINFLNHCYIDTEVEMKEIYTSNHMWSLF
EKSFIVDMGLIATSTHDRQHADTALETYVTSCLMNIISTFFSSPFSDQSTTVQTRQPIFV
QLLHAAFNVSQCAWLNAGQRFNVENCIRTLSDVAKGRGIAIPTDLESQVANMFNKAAMLS
RQTSKWLQAAKQPKIERSQSQLMRLDRSIIEGLQDIVSLLEEQLKPLVQSELSLLVDILY
RPELLFPAATDARKRCENGGFIKRLIKHTEKLLEEKEEKLCVKVLRTLREMMAIDPEYGE
KGDALRNNLLTRYFGKSFIQNPENVDIGVSRSATITHGPGAKILSRAGRTLHDVQTHLDR
EGASDLVVELVIKSVHSPSIFVEVVELGIALLEGGNPIIQRSIFNKLMGADLSQSFFKVF
YDKMKDSQQEIKSTVTVNTSDMAAKAHEDKEGKEVDKLSRKRGSGKPNGMVITDELHEEL
NQVAASNAQAYANMRNGLAPGEDTANTLDDLSEKSDRNKSGNSSGGEKEEGQLSPKVLVM
QPILRFLQLLCENHNRELQNFLRNQNNKTNFNLVSETLMFLDCICGSTTGGLGLLGLYIN
EYNVALINQTLETLTEYCQGPCHDNQNCIATHESNGLDIITALILNDINPLGKTRMDLVL
ELKNNASKLLLAIMESRGDSENAERIMYNMNPKQLVDVACKAFHQESLDDFSDIDDSSTN
AEEGVSPKEVGHNIYILCHQLAQHNKELAVMLKPSEQNNADPKINKALEYYASHTAQIEI
VRHDRTLEQIVFPIPEICELITMDTKIRVLNTTERDDQGSKVSDFFERTEDMFNEMKWQK
KLRGQPLLFWMSSYMSLWSNILFNCAVLINLIVAFFYPFVDSVPKLSYHLSALIWTVMLA
SAAIIITLPRESGIRTFVASTILRLIFSVGPEPTLWLLGFVTITLKVVHLISIIGNQGTL
TRSVEQIITNIELLYHMSYITFCVLGLFMHPFFYSVLLFDVVYREETLLNVIKSVTRNGR
SIILTAVLALILVYMFSIIGFMFFKDDFLVPVDEEIISSIEQKIANTCSAGSKENCDATE
TISHYASEANVRENKPEIVNVGGELKERTCDSLVMCIVTTLNQGLRNGGGIGDILRAPSS
VEPLFVARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKELILKNTCFICGLNR
SAFDNKIVSFEEHIKHEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKDRNLEWFPRL
RAKSLAADEGEGEQVELRSLQSQLESTQMLVRCLSQQLTELRDQIARLCKIGMLFKRKAS
YCINAQ
Download sequence
Identical sequences A0A158NQV4
XP_012059912.1.45171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]