SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A158PFZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158PFZ7
Domain Number 1 Region: 9-250
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.06e-78
Family Capz alpha-1 subunit 0.000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A158PFZ7
Sequence length 256
Comment (tr|A0A158PFZ7|A0A158PFZ7_ANGCS) Uncharacterized protein {ECO:0000313|WBParaSite:ACOC_0000463101-mRNA-1} KW=Complete proteome; Reference proteome OX=334426 OS=Angiostrongylus costaricensis (Nematode worm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MTSEVTIPDSEKIRIVSDFLQHAPPGEFNEVFNAVRMLLNNDQLLKEGCSQAVVRYNESQ
FAPVKLDGVEKQTLITAFNDIGGGRYVDDASKKSFKYDHLRKEASDIQPYPAESTALESW
RAALQKELDIYIEEHYAKSGIGCVFVRNGNFTNGRWRSEWKIPVGDGKMGAQELIGNVKV
QVHYYEDGNVQLFSEKDFSVKIQVTSDVDKTAKEILQSIRDEEGKYQHAVQENYASMSDN
TFKALRRQLPNFHKPR
Download sequence
Identical sequences A0A158PFZ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]