SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A158PK86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158PK86
Domain Number 1 Region: 247-424
Classification Level Classification E-value
Superfamily MIR domain 3.05e-40
Family MIR domain 0.0000293
Further Details:      
 
Domain Number 2 Region: 426-509,540-627
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.15e-37
Family IP3 receptor type 1 binding core, domain 2 0.0000133
Further Details:      
 
Domain Number 3 Region: 1163-1319
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.11e-23
Family IP3 receptor type 1 binding core, domain 2 0.0088
Further Details:      
 
Domain Number 4 Region: 110-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000000471
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A158PK86
Sequence length 1554
Comment (tr|A0A158PK86|A0A158PK86_ANGCS) Uncharacterized protein {ECO:0000313|WBParaSite:ACOC_0000973701-mRNA-1} KW=Complete proteome; Reference proteome OX=334426 OS=Angiostrongylus costaricensis (Nematode worm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MSRLFLHKNSLCMSTDNGNTSLLHFGDIISLYTEETADLPMPVCNVYHIILVSDCLFKVC
PVNRYAAQKQFWTEQKRFVSGESTFDNDMMNKLRIAAEKEKEQNELEFRKTLGNVIQYGT
TVQLLHVKSDKYVTVQKNSPAKCERNAMKVYLDRAGNEGSWFIIEPAYKHYVIGDSVAAG
NKISLIPYSVNNQSSSGHVKHQLHLSHFLLKDHQTAVEVNCLNESTEWQVFMFLLFNENQ
PDIIKSGDVVRLFHADQQTFLTLDSVPNTSPPQDVVFLRMTNRPSAADATSSRALWEVQV
VQKDAYRGGAANWREYYRFKHLATDMYLTAIPTTSAMKPSTSCRRVNLMQMKYATYYYLD
FLNKDVPCKSYVRLQHDVTNTWVHATNANDKQNLYYSSKNEKGWVRVICANNRVDKETFA
LLPVHPNEVRDLDFANDACRALRNFIRQIGSGEPVTKEAINVTIQLLTECIYFVTNTKNH
MMDPLQITDFTPSRDRQKLLREQEVLDQVGFLVFYPTETLWNATYLLDQMLMVFYDAVVF
QLLKAPFMPRQGVTEIGPLLSSLSDLSEGRNEVFKTMFQLCYSLLRYSQVSYRKNQEFLA
EKFGQIQEQIGYDLLAEDTMTAVLHNNPKLLEKYVKTPHVERFVELIVIVKDYRFLDYLA
DLCVCRGEANKKVQELICNSVLSEKHRDIIMETKLVRVNGEVHIGWINQQLRSLVELAES
VKEDTNDAEHQLDLLAQMCQEQQYLAIDPPPERKLLNISHQLPAELVLKCMSDARLPCEV
RASFARLMLHLHVVRGSPLNAIRHARLWTDIPVEVKLKSYKITSLEGYSDGGRARVGDQF
ATDVLNTVESYLNSLRHSRSSEPILKNDAASVANNKLTYEMVTLAKALAQFGYYMFDNLL
TLTENLLNIVDNSPYNPQTGEKVFSAHSVSQGMSMIHRVTQSMIGSGSRKLCDGPIMRNS
EKSNIEDSGQAKESRQLLVKTKLTVAEILQVRYSESMPFQFVMDVRRDYRITMALSWFKK
NFPCDENGVLSRTANINEWTQTIHDRIHFQMTMSDYPPLTSIALKVLFRHFTQYQELLED
LKQVQLLVSSDDVENYRLIDRDLFILKNLTEKSELWVHGERHHSIDSKDHEKEDKITKTD
FEEHLLFTSKAFTSEDILRSIIDIIDEHYSNSRKDCLRLLNQLLISENRTLANAALQELN
DRTPLIAYPLIRQILVRLKKLCYKKDRPDSMNQQLLKNMRVYEVVLEFLSIPYDKKNDIE
MPRLITLSHEFLRSFCKGNKENQSRLHKYISIEKDAKEGTLRVETVEEAATLVAIFRNNR
ELAANVSEDLIAHIVSLIEHKSRNAVFLELLQSLVCIHDKEVETTQDKVATEICAASDEV
RALYVDNASFEQLEQMMQEASSYLDNTHPLKYHIELVRLLAMCTRGKNGSTELKCASEIP
MDHIVRVVTSQSCLVEVSVKTAYFQFLLHCYIDTDAEMKDAYKPEYVDSLLHNMLLDVQK
LEKGLAASPNSCGLLEQYVCSTVTEILLRFFEKPYSEQAKVDIHVSDIPFLSHA
Download sequence
Identical sequences A0A158PK86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]