SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A158PMT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158PMT1
Domain Number 1 Region: 534-705
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.15e-43
Family IP3 receptor type 1 binding core, domain 2 0.00000807
Further Details:      
 
Domain Number 2 Region: 292-392,432-532
Classification Level Classification E-value
Superfamily MIR domain 3.49e-35
Family MIR domain 0.0000608
Further Details:      
 
Domain Number 3 Region: 1280-1438
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.12e-23
Family IP3 receptor type 1 binding core, domain 2 0.0088
Further Details:      
 
Domain Number 4 Region: 154-226
Classification Level Classification E-value
Superfamily MIR domain 0.00000000497
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A158PMT1
Sequence length 2921
Comment (tr|A0A158PMT1|A0A158PMT1_ANISI) Inositol 1,4,5-trisphosphate receptor itr-1 (inferred by orthology to a C. elegans protein) {ECO:0000313|WBParaSite:ASIM_0001012401-mRNA-1} KW=Complete proteome; Reference proteome OX=6269 OS=Anisakis simplex (Herring worm). GN= OC=Ascaridoidea; Anisakidae; Anisakis; Anisakis simplex complex.
Sequence
MQKRRLYGGMSMNLSIDAFHNTSLHIGDVVSLYTEDRNRLIDDKPDDRLLVKTGFLSTLG
LVDDRCIVEIGDGGPDSPPKKFRDDVIRHTRNANDIVDCLFRICPINRYAAQKQYWTEQK
KFQAGESLFEEDMLKKLKNAADKEKEQNEMEYRKMLGVTVQYGGTVQLLHVKSDKYLTVM
KNSPAKLERNAMKVYLDKTGNEGSWFYVEPVYKHSFLGDNVNAGDRISLVPYSYGSTSVS
TGHIKPQIHLSQMRLSDHPSACEVNCLNELTEWQVFMFLQFDENQPDIVKSGDVVRLFHA
DQQTFLTMDTIPKKSIDVAFLRMTNRPSAADATSSRALWEVQARKSSVVHAEAYRGSAAS
WMERFRFKHLATDMFLSVEKLSNNSMRTPEYLSVQQNLCSPEIIWRQKIPNENFKKLSYC
KFFGVFFAVERDDGSCNVDDQYYLVPKHVEQPENDESIVFMLDPCALTKMEARVPQRTFV
RLFHVLTKTWIHTMDPTEKHNLYHFSKNEKGWVKVVSEDFKIDKETFALLPVSPDEVRDL
DFANDACRALQNFIALIRTGKIISKEPLNVTIQLLIECIYFVTNETNHMIDPLRIIDFKP
SRDRQKLLREQGVLDQIFDLLRAPFLPRQGVTEIGPLLNSPQELAEQRNEVFKRMFQLCY
SLLRYSQAGYRKNQEHLAEKFGQIQEQIGFDLLAEDTMTAVLHNNPKLLEKYVKNPHVER
FVELVRNNRAGKFLDYLADLCVCRGEANKKIQELICNCVLSETNRDIFMQTEIADCGGTK
EVYICWPDRYCKALVNVAESATTGNTEDSEMLDYYRHQLDLLAQMCQEQQYLAIDPPPER
RLLNLSTELPADLVLRSMSDNRLPQELRASFTRLMLHLHVVRGSPLSAVQHARLWRDIAE
HVSVNSNSNRSVVGYVDGGRVRTGGEVFKKILTTVDEYLAELRSSTRRGEPVLSASAAKL
EQNRLTFEIVTLARALAQFGFYSFAELLKLARNLLAITDSSPKEAAVKKLCNKTTNAIFR
QVTYSVMSVGIMHNASLASAHSLGSDTLDAEENARAKESKEMILQTKLIVVEILQFIMDV
RRDYRITVALSWFKRHFPCDEWGELTSNFSMSHLIVHLGELSEAHASELYEEVFQKTEDS
LDFDGEGGQQLLRILLQMTMSDYSKLTSTALKVLFRHFTQYQELVEDLKQVQLLVSNDDV
ENYRQVDRDLFILKILTEKSELWVHADKRASGSSTNQSLEDMRLSLSTDELQRPSTVQQL
QNSGLNAPRAFHHDECFRSLVEKLDQHYSPTRDDCIRLLHELLLGEDRANAAAALYELSD
RAPLVGYPLIRQILFRLKQLCFKDGRPDVMNQQLLRNMRVHEFVLEFLSVPYDKKNDMEM
PKLLTLSHEFLRSFCRNNKENQSRLQKHITIDTDAKEGCLRVDTVEEVATLVAIFKNNRD
LSQNVSEELIAHVVRLIEHKARNATFLEFLQCVVCVYEKEIESSQEKVAQEICSASDEVR
IFYSDSASFEQLVGMMQNTPPEELNADHPLRYHIELVRLLAMCTRGKNGTTELKCASQLP
MDHIVRVVTSPHCLIQVKDVYLQFMLHCYIDTDAEMKDVYNVDYIEQILSNMLADIQKLR
AEGHLLLPGSALERYVCHTVTEVLVKFFEKPFTDQPLVEISQYRGSFMKVIQNLSYLQSE
WSRRRSSTKNWYRIAECVKRLTKCGELCYLMSSNLDVGNDDDVLDQLLSRSARKNGLRNL
AEEHGLMLPANLTAPPLSGATTPKQRWQTAAHSARFIKRNQATLRIKSQLSMPHFSKTID
THTNVVTCYQGVVAEFRIFALPLQGAEASVLVDVLHTPERLFPVGSELHEKCENGGVVAK
LIQHCKHLLQHGQENLCVRVLQTLCRMATSAKHNFNQQGRRVRRQLLKRYFGSEVFDGIG
SKNKDENDDTVSTINSYHNESELRPLRETSLHDVQCKLNSAGASDLVVDLIVQDPSHDVF
LMSIQLAKALLHGGNHEVQTSFYNRLRKRNVSEPFFKALKTKLQVAQNRLKSDMMACSDL
RQKPASVMNTPLPDEQSNFVNDELIKKISVGELAVPVPLQPDNLIVGSSIPDISPYQDDE
RPKALLPPEVAIIEPILRFLQLLCENHNALLQNFLRSQGSRQNYNLVDETLMFLDVVCGS
TKGKSDASFAGSLGVFGEIGEHNFSLITQTLVTLTEFCQGPCHENQSDASKLLLAVMESR
HDADNAERVLENMSHMTSGPAQLIHAIKMAYEMATSQSLAVNKFKKQLTEANMSTTKDNK
KGKLVKPPEISLPEANAELYTQKESSSAIVDPQEVGHNIFILATQLSRHNDELKLMLDPE
NCEDDMTHTVLTYYKRHTAQIEIVRVDRKMERVIFPIHPICEHLTPETKQNIFTETERDA
QGSKVTEFFEQWPKLFEEMKWQKKLQDRKYLSNCTKRLILWARLSFFFAVLANGIIALFY
PFSDDNNTEFFSPNNPLIYALTLASMLFIRTQWSDKASLGRTHEAYWGIASVMFSFTIFF
IAVFGVVPTLFIVGILQLINKVIHLISYIGNRGLIDKTWSERIEDKDVWYHLVYLSVCFI
GFVAHPLAYSLLLFDIVASEETLRNVIRSVTRNWQSIIMTGLLALILVYMFSIVGYLFFQ
RDFQLEVDSIEDEPNNPSDAMLCDGPNNTYFGENNTVNTEGTCSAGLKQAERENDNDDDS
KIRSCETLRMCIITTLNWGLRNGGGIGDVLRNVAPDEESFFARIFYDMAFFIVLIVIVLN
LVFGVIIDTFGDLRAERNEKDDILKNTCFICGLERGRFDNKSVTFEEHRSSEHNLYHYLY
FIVWLQVKDETEFTGPESYVSQCIKEHNNDWFPRMQAMSLAEDDQEAEQPEQISDIREMV
NTLLTIVRSHDRQFEELRQVIYEQNALQARNPAPTIRTRLY
Download sequence
Identical sequences A0A158PMT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]