SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A158Q3L2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158Q3L2
Domain Number 1 Region: 412-581
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.36e-44
Family IP3 receptor type 1 binding core, domain 2 0.00000675
Further Details:      
 
Domain Number 2 Region: 277-410
Classification Level Classification E-value
Superfamily MIR domain 5.23e-25
Family MIR domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1107-1264
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.28e-20
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 
Domain Number 4 Region: 138-210
Classification Level Classification E-value
Superfamily MIR domain 0.00000000235
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A158Q3L2
Sequence length 2564
Comment (tr|A0A158Q3L2|A0A158Q3L2_DRAME) Uncharacterized protein {ECO:0000313|WBParaSite:DME_0000263901-mRNA-1} KW=Complete proteome; Reference proteome OX=318479 OS=Dracunculus medinensis (Guinea worm). GN= OC=Spirurida incertae sedis; Dracunculoidea; Dracunculidae; Dracunculus.
Sequence
MNLGSNKTRQKLFYDKSNLSSEVFHNSTLHIGDVISLYTEDRSRQSDDRNDDRTFIKTGL
VDDRCIVEIGDGNPEAPPKKFRDCLFRICPINRYAAQKQFWTEQKRFREGESVFEEDMLA
KLKNAADKEKEQNEMEYQKMLGSIVQYGGTIQLLHVKSDKYLTVMKNTPAKLERNAMKVC
LDKTGNEGSWFYVETVYKHSFLGDNVNSGDRISLVPYSYGSLSGNTGIIKPQIHLSHMRL
PDHPQGYEVNCVNEHTEWQVFVFLQFDENRGDIIKSGDVIRLFHADQQTFLTLDTIPKKG
KDVVFLRLTNRPSAADATSSRALWEVQVVQNEACRGAAAAWHERFRFKHLASDMFLTVKS
ARDMRDVLDMPPASSIPENIFDYSKNEKGWVKVIGEDQRVDKETFALLSVHPNEVRDLDF
ANDACKALTNFIDLIKSGKIIAKESLNIIVQLLTECIYFVTNQANHLVDPLKIVDFIPSR
DRQKLLREQGVLKQTFELLRVPFEPRRGIMGPLLLSPQELNEQRNDVFKRMFQLCYSLLR
YSQVRYRKNQEHLAEQFGLIQQQIGFDLLAEDTMTAVLHNNPKLLEKYVKDPHVQRFVEL
VRNNKTGKFLDYLADLCVCRGEANKKVQELICNCVLSEANRDIFMLQIKWGDRYMKSLIA
MAKGVSIGDQEDSEMLDYYKHQLDLFAQMCQEQQYLAIDPPPERHLLNLSAELPPDLVLK
CMSDSRLPDNLRASFARLMLHLHVVRGSPLNAIRYARLWKEIPERVSILNCSSRPVEGYA
TSGRARSGYANLLKAVSDYLLSLKNITKSGENVLNDHSSRLEQNRLTFEMVTLARALAQF
GFYSFAQLLQLAESLLAITDNNSSTTPASHFFHQVTYSVMGVGMLEKSGTLNSTLANDAV
DVEENVRSKASKDIIMEIKLIVVEILQFIMDVRRDYRITVALSWFKQKNPCDEYGELTEP
QALTTKHAMEIYKEIFERTEEQLECGGQHGRQLLKTLLQLATSECAKLASSALKVLFRQF
TQYHEFVDDLKQVQLLVSNEDVENYCQIDRDLFILKILTEKSELWVNAGKASESPIIDDT
LRIEDISADGLNAPRAFCNDESFHLLVDKLDEYYSPTRDDCIKLLNKLLLSDDRENAASA
LFELSDKAPLIGYPLIKQILFRLKQLCYKNGSNDIMNQQLLKNMRVHEYVLGFLSIPYDK
RVDQEMPKLFTLCHEFLQSFCRNNKLNQYCLQRYISVDSDHKEGCLRIDTVEDVATLVAI
YKNNRKLSENISGDIIARVIDLIEQKARNAVFIEFLQCVVCTDEGEIESSQEKVVQEICS
ASDEVRVFYSDSASFEQLIQMMKNTPVEELTADNPLRYHIELVRLLAMCTRGKNGTMELK
CASQLPIDHIMRVLSSPHCLVQVKDVYMQFMLHCYIDTGAEMKDVYNADYFELILQNILS
DVEEVPLERYICLTVIEILSSLFQKPLSYQTTMDVVSHITIYFLYKSSVKTLRSASKNWH
RFAESLKRLNKCGSYFSILQNYNHEFEESSRFLEDAETSVLVDLLYSPERLFPKGSEMRE
RCEKGETIAKLIEHCKQLLEEKQENLCVRVLHTLCHMATNTKFICRDQVNCLFHIFTRTN
CKIGICLRQHLLQRYFGDESERRRSKFGSIIEKQERKPSSSNLCRNYFPTILFTDLFSDL
VIDLIIEEPSYDVFYMTMELAKSLLQEGNEQVQKSFYKRLTQQRDVSETFVQAIKTKLQV
AQNRVKNDMMACNDSRQPSCLQTPLANDLTLQNEHRGSLDTSINLMSLQAENIDAIYFYR
SKKSLPPEVLIIEPILRFLQLLCENHNLSLQNFLRCQGSRKNYNLVDETLTFLDVICGST
KGSLGVFGDIGEHNFSLIIQTLTTLTEFCQGPCHENQNAIVYHETGLNMIISLVLNEIKP
LCISHMDLALEIKSVASKLLLATMESRHDASNAEAVLLNMSHMNSGPTQLIHALTVAYQM
ANSDTYVLSRMRRQLLENNISGQVLPEISVHGPVKNIFDQKFSYSNLVDPQEVGHNIFIL
ATQLSRHDKSLRDLLTADYFDCEMTRVAITYYKQHTAQIEIVREDRRMERVIFPIHTICK
YLTPETKQNLLVETERDAQGSKVSQFFDQWPKLFQEMKWQRKLQDRKYLSSCTKHLILWA
RLSFLFAIFTNIITAIYYPFNEDTRHASFGREPEAYIGIAVVMFISTLLAIRSLDVLLTL
QLIGILQLVNKFVHILSYIGNRGLIDRTWSDRINDRDIWYHLLYVVICLFGLSIHPLFYA
LLLFDIVSSDETLRNVISSVTRNWQSIIMTGLLALILVYLFSIIGYLFFQKDFRLEVDPM
NSYAGESKANDGKIWSCQTLRMCIITTLNWGLRNGGGIGDILRNVPPDEESFFPRILYDM
SFFIVLIIIVLNLVFGVIIDTFGDLRAERNEKDDILRNTCFICGLERGRFDNKKVTFEEH
RKNEHNLYHYLYFIVWLQIKDETEFTGPESYVAQCIKDRNNDWFPHMQAMSLIDGEGQEL
EQPEEFNNLKEMLNTLLAVSKNHDRQLEELRQQFVAFSKFSAVS
Download sequence
Identical sequences A0A158Q3L2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]