SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A158R5B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A158R5B0
Domain Number 1 Region: 485-656
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.31e-43
Family IP3 receptor type 1 binding core, domain 2 0.00000794
Further Details:      
 
Domain Number 2 Region: 277-483
Classification Level Classification E-value
Superfamily MIR domain 4.8e-42
Family MIR domain 0.0000128
Further Details:      
 
Domain Number 3 Region: 1265-1383
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.59e-24
Family IP3 receptor type 1 binding core, domain 2 0.0072
Further Details:      
 
Domain Number 4 Region: 139-210
Classification Level Classification E-value
Superfamily MIR domain 0.00000000641
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A158R5B0
Sequence length 2880
Comment (tr|A0A158R5B0|A0A158R5B0_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:SMUV_0000616401-mRNA-1} KW=Complete proteome; Reference proteome OX=451379 OS=Syphacia muris. GN= OC=Oxyuroidea; Oxyuridae; Syphacia.
Sequence
MLDRQMYSGSLSLNMSLDAFHNTTLHIGDVVSFYTEGRSRQSDSDNPSVINCGFLSTLGL
VDDRCIVENGDGGPESPPKKFRDCLFRICPVNRYAAQKQYWTEQKKFQNGERTFEEDMLK
KLKNAADKENEQNDMEYRKMLGVPVQYGGTIQLLHVKSDKYLTVMKNSPAKLERNAMKVY
LDKTGNEGSWFFVEPVYKHSFLGDNVNAGDRISLVPYSYGSASGIGSHVKPQIHLSHMRL
LDHSTACEVNCLNELTEWQVFMFLQFDENQPDIVKSGDVVRLFHADQQTFLTLDNIPKKG
DDVVFLRLTNRPSAADATSSRALWEVQVVQPEPYRGGAANWIQRYRFKHLATDMYLSVEG
VKRENRHHTSKSGPSGEALESDDIEDDDEYDYYYLVPKNSERPEDDPTLIFVLDPCTLTK
MEARIPQRTYVRLHHVMTKTWVHTTDPTKKENLYYISKNEKGWVKVVNENFKIDKETFAL
LPVSPDEVRDLDFANDACKALDNFISHIKHGQIISKETLNFTIQLLTECIYFVTNETNHM
IDPLKIVDFKPSRDRQKLLREQGVLAQIFDLLRAPFLPRQGESEIVPLLNSPHELNESRN
EVFKRMFQLCYSLLRYAQVGYRKNQEHLAEKFGQIQEQIGFDLLAEDTMTAVLHNNPKLL
EKYVKTPHVERFVELVRNNKAGKFLEYLADLCVCRGEANKKIQELICNCVLSEANRDIFM
KTELADCNGQEEVYICWVDDYRETLVDISKNATTDRSRDRTDAEILDYYKHQLDLLAQMC
QEQQYLAIDPPPERHLLNLSTELPAELVLKCMSDDRLPHDLRASFTRLMLHLHVVRGSPM
NAIRHARLWSDIPDTVSVEKSSNHSVKEYVDGVRVRSCDVHKKILMMVEKYLEGLRTSTA
KGEAVLDPSGENLEQNRLTFEIVTLARALAQFGFYSFAELLKLAQNLLAITDSNPKLSPV
RNVCDKMSALFRELTYSVIRLGKTPKASLSKSHSITSDSLRADESARAKESKEKVLETKL
IVVEILQFIMDVRRDYRITVALSWFKRRFPCDEVGELTAQIDELTEKQAADLYREIFQKS
EEELDFDGEEGQQLLRILLQMTMSDYSKLTSTALKVLFRHFTQYQELVDDLKQVQLLVSA
NDVDNYRQVDRDLFILKILTEKSEVWVHADKNRLDELSGRIHDESRKNSTDNASNKIYRQ
TIAQQLQESGLTAPRGFQHMESFQNLIEKIEQHYPLARDDCIRVLRELMLGEDGSTASAL
YELSDKVPLVAYPLIREILCRLKNLCFKDGKPDVMNQQLLRNMRVHEFVLDFLSIPYNKK
NDAEMPKLITLGHEFLRSFCRNNKENQIHLQKHISIEQDAKEGCLRVNTVEEVATLVAIY
QNNRELSQTVSEELIAHVVSLIEHKTRNAIFLEFLQCVICVYGKEISSSQEKVAQEICSA
SDEVRVFYSDSASFEELVKMMQTTPPEQLNAENPLRYHIELVRLLAMCTRGKNGTTELKC
ASQIPIDHIVRVITSPSCLIQVKEVYLQFMLHCYIDTDAEMKDVYNVDYIEQILSNVVVD
IQRLGKQTHPLIPGSALEKYICYTVTEVLIKFFEKPATDQPMVDVSKLYVKQNRGTLIKV
IETLNHLQNEWAKKKNSTKTKFFAYVAAEENGIIVSTSGHPVANNASVKQRWQTAAHSSR
FITRNLKNRAQLSMPHFSKTIENHTNVVTCYQAMAAEFKIFALPLQAAEASVLVDVLHTP
ERLFPVGSELRERCENGGVVAKLIQHCQHLLQHSQETLCVRVLQTLCRMATSAKHNFNQQ
NTSIELALKHGPWGRKVRRQLLERYFGSEAVHGGPLRTESEKDNGYDDGIDPLHGELKPL
RETSLYDVQCKLNNAGASDLVIDLIVQEPSHEVFFMTIQLAKALLHEGNNEVQMSFYNRL
KRRNVCEPFFSALKTKLQMAQNRLKSDMMACSDPKQRGIDFRYLLMPLLCKMSITLKLLF
ILASTLNTPQPEDGVLPSEDVGKKSRDSSVSELTIPTTLPPDSLPAGCNAQEINLYQDDE
RAKGILPPEVAIIEPILRFLQLLCENHNLLLQNFLRCQNSKQNYNLVDETLMFLDVVCGS
TKGSLGVFGELGEHNFSLVKQTLVTLTEFCQGPCHENQNAIGNHESGLNMIISLVLNEIK
PLCISHMDLALEIKSDASKLLLAVMESRHDADNAERVLMNMKHMTSGPKQLVYAIKVAYE
MATSDKYAVTEFRRQLLENHPRTPSESRSRTNTVPEITVPPDTGNEEYESKEISSTLVDP
QEVGHNIFILATQLSRHNEELKTMLDPENCKDPSTRTALAYYNKHTAQIEIVRSDRKMER
VIFPIHTICEYLTPETKQNVLLETDRDAQGSKITEFFEQWPRLYEEMKWQKKLQDRSYLS
NCTKRLILWARLSFFFAVLTNSLIAIFYPFSSDGTGITEASSNAFLYASALGSMLFLHTQ
WNEKASLGRTTEAYWGIAAVMFSFTMLLITIIGVVPTLYIVGVLQLINKVVHLISYIGNR
GLIDKTWIERIEDKDIWYHLLYLTICVLGLIGHPLLYSLLLFDIVASEETLRSVIRSVTR
NWQSIIMTGLLALILVYLFSIVGYLFFQKDFQLDIDRIDQMTEDSLAKGVVPTECDGSNK
TYFGSNESQFEGTCRPVSLENNDETEDDGKIWSCQTLRMCIITTLNWGLRNGGGIGDVLR
NVPPQEESFLPRILYDMSFFIVLIVIVLNLVFGVIIDTFGDLRAERNEKDDILRNTCFIC
GLERGRFDNKIVTFEQHRESEHNLYHYLYFIVWLQIKDETEFTGPESYVAQCIKDRNKDW
FPRMQAMSLAEDDQETEQPEKISDMKDMIGSLLNTVKSQGRQLDEIKQVNELMWFYILDI
Download sequence
Identical sequences A0A158R5B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]