SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A159B6W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A159B6W2
Domain Number 1 Region: 7-334
Classification Level Classification E-value
Superfamily Baseplate structural protein gp8 4.71e-153
Family Baseplate structural protein gp8 0.00000000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A159B6W2
Sequence length 334
Comment (tr|A0A159B6W2|A0A159B6W2_9CAUD) Putative baseplate wedge subunit {ECO:0000313|EMBL:AKJ72684.1} KW=Complete proteome OX=1654926 OS=Escherichia phage HY03. GN=HY03_0020 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae.
Sequence
MNDSSVIYRAIVTSKFRTEKMLNFYNSIGSGPDKNTIFITFGRSEPWSSNENEVGFAPPY
PTDSVLGVTDMWTHMMGTVKVLPSMLDAVIPRRDWGDTRYPDPYTFRINDIVVCNSAPYN
ATESGAGWLVYRCLDVPDTGMCSIESLTNKDECLKLGGKWTPSVRSMTPPEGRGDAEGTI
EPGDGYVWEYLFEIPPDVSINRCTNEYIVVPWPEELKEDPTRWGYEDNLTWQQDDFGLIY
RVKANTIRFKAYLDSVYFPEAALPGNKGFRQISIITNPLEAKVHPNDPNVKAEKDYYDPE
DLMRHSGEMIYMENRPPIIMAMDQTEEINILFTF
Download sequence
Identical sequences A0A159B6W2 C3V1L6 D4Z9V6
gi|228861469|ref|YP_002854490.1| YP_002854490.1.52523 YP_009167971.1.41807 YP_009284015.1.77798 C3V1L6_9CAUD D4Z9V6_BPAR1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]