SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A161PTA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A161PTA4
Domain Number - Region: 39-81
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.034
Family Preprotein translocase SecE subunit 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A161PTA4
Sequence length 82
Comment (tr|A0A161PTA4|A0A161PTA4_RIEAN) Uncharacterized protein {ECO:0000313|EMBL:KYG12548.1} KW=Complete proteome OX=34085 OS=Riemerella anatipestifer (Moraxella anatipestifer). GN=AWB56_03200 OC=Flavobacteriaceae; Riemerella.
Sequence
MSFGNKNLGKGSFSDRASKKVEASFTNEANQMVDEISSKGKKIAEQNEKVVKDTLKIGAG
CIMLTILSILGFVGFIIYLIVS
Download sequence
Identical sequences A0A161PTA4 E4TD33
WP_013447130.1.12819 WP_013447130.1.21683 WP_013447130.1.27570 WP_013447130.1.28646 WP_013447130.1.34653 WP_013447130.1.34861 WP_013447130.1.3884 WP_013447130.1.46459 WP_013447130.1.49580 WP_013447130.1.51207 WP_013447130.1.5278 WP_013447130.1.55645 WP_013447130.1.58109 WP_013447130.1.6213 WP_013447130.1.70085 WP_013447130.1.72231 WP_013447130.1.78695 WP_013447130.1.8112 WP_013447130.1.82490 WP_013447130.1.9884 gi|386321002|ref|YP_006017164.1| gi|442313712|ref|YP_007355015.1| gi|313207021|ref|YP_004046198.1| gi|313207021|ref|YP_004046198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]