SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A161ZPZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A161ZPZ5
Domain Number 1 Region: 31-207
Classification Level Classification E-value
Superfamily MIR domain 3.53e-58
Family MIR domain 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A161ZPZ5
Sequence length 216
Comment (tr|A0A161ZPZ5|A0A161ZPZ5_DAUCA) Uncharacterized protein {ECO:0000313|EMBL:KZM88500.1} KW=Complete proteome; Reference proteome OX=79200 OS=Daucus carota subsp. sativus. GN=DCAR_025575 OC=Scandiceae; Daucinae; Daucus; Daucus sect. Daucus.
Sequence
MALSFFGIAAFLFLSLDSEYGFNYPASAAVSEGVEITYGSVIKLMHEKTRFRLHSHEVPY
GSGSGQQSVTGFPNVDDANSYWTVKRIPESSAKQGAPIKSGTIIRLQHMRTRKWLHSHLH
MSPISGNQEVSCFGDDSNSDTGDYWRLEIEGSGKSWRQDQKIRLRHVDTGGYLHTHNKKY
NRIIAGQQEVCGVRDKLPDNIWLASEGVYLPVSASK
Download sequence
Identical sequences A0A161ZPZ5
XP_017216144.1.63501 XP_017216145.1.63501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]