SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A162J6D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A162J6D6
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000641
Family Preprotein translocase SecE subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A162J6D6
Sequence length 70
Comment (tr|A0A162J6D6|A0A162J6D6_9PEZI) Protein secE/sec61-gamma protein {ECO:0000313|EMBL:OAA64372.1} KW=Complete proteome; Reference proteome OX=1081102 OS=Sporothrix insectorum RCEF 264. GN=SPI_03019 OC=Sporothrix.
Sequence
MSDQVQEILDVPREFVKDGMQFINRCQKPDTKEFIKISQAVGVGFLVMGAVGYFVKLIHI
PLNNILVGGA
Download sequence
Identical sequences A0A162J6D6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]