SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A162U1U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A162U1U9
Domain Number 1 Region: 5-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.92e-88
Family Capz alpha-1 subunit 0.000000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A162U1U9
Sequence length 278
Comment (tr|A0A162U1U9|A0A162U1U9_PHYB8) Uncharacterized protein {ECO:0000313|EMBL:OAD71643.1} KW=Complete proteome; Reference proteome OX=763407 OS=NBRC 33097 / NRRL 1555). GN=PHYBLDRAFT_159308 OC=Phycomycetaceae; Phycomyces.
Sequence
MEDISIEDKVKIASGFLLASPPGEVNDVFNDVRTLVDDDKALESGILTTLEEYNTEQLIT
VIPPGLDYEVIVSKHGKVDLDRYLDPRSKKSFQFDHIRLVATELKDHTEDLPIEDFRAAV
ETEAHKYVNDHYPNGVCSVYGLDENNIAIAIVDNKYNPNNYWNGRWLATWVYNRETGALK
GATKVHVHYYEDGNVQLNSDKKSDSTVTFKEDVTVTAKAIVKEITTFDKRYHTAVNNSYE
ELAENAFKGLRRALPLTRNKLDWNKIMNYKIGNELSQK
Download sequence
Identical sequences A0A162U1U9
XP_018289683.1.77709 jgi|Phybl1|33573|estExt_Genewise1.C_310076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]