SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A162U945 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A162U945
Domain Number - Region: 123-235
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0732
Family Capz beta-1 subunit 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A162U945
Sequence length 428
Comment (tr|A0A162U945|A0A162U945_PHYB8) Uncharacterized protein {ECO:0000313|EMBL:OAD74462.1} KW=Complete proteome; Reference proteome OX=763407 OS=NBRC 33097 / NRRL 1555). GN=PHYBLDRAFT_167871 OC=Phycomycetaceae; Phycomyces.
Sequence
MVHFLDKGKPENNESSNSLHRSPASMSSSSYSSSSRTPESISIAEQHNLSNTLPRMHYIL
LWNIILEALVVSALEAALIYYHVSFSSHCVLSITNMGLSLANVTHHGLAIITQVYQVLLY
IDLLKQHNMPQLCMTMIFQTLILVFAIIKVYHSSLKDFMICDDSLEGNNTFSTTNYPLVF
TRNDTEFYKTKFQSLEYAVFGVTLACSIVFLLCLIRLYRASTWTSHYLHSFDDNTKKAIL
AATALVSLLKFDAFFCFFYIVQLVPATITGYPVPYWEVPAVVLASALILLLGWYAVLKES
SQLTLAFATATILSFGYFVYRIISLSLVSVLNQEILKIIRSYLQLSISITLVFTLLTIVV
SLTCFLNQIRGINLPQPMCHSCTHPQKKPPPMVPEHTEPPYSMGTALRSEPKQSTDTCFF
SDCHSVIK
Download sequence
Identical sequences A0A162U945
jgi|Phybl1|67613|fgeneshPB_pg.19__146 XP_018292502.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]