SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A162ZCC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A162ZCC5
Domain Number 1 Region: 27-197
Classification Level Classification E-value
Superfamily MIR domain 1.29e-49
Family MIR domain 0.00000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A162ZCC5
Sequence length 209
Comment (tr|A0A162ZCC5|A0A162ZCC5_PHYB8) Uncharacterized protein {ECO:0000313|EMBL:OAD65821.1} KW=Complete proteome; Reference proteome OX=763407 OS=NBRC 33097 / NRRL 1555). GN=PHYBLDRAFT_175784 OC=Phycomycetaceae; Phycomyces.
Sequence
MKLIWLAFIPLAFAASSVPPLEEGFQHVTCGSTIKLSNQANQHRLHSHGVSYGSGSGQQS
VTGFSSSDDANSFWLLRAAFGKQCKRGDPVPCGSIIRLRHTNTNGYLHSHNHKSPLSSQQ
EVSCYDGNDTGDDWRVECASGSKFWLREEPVQFVHVESQAYLSCNGAHQFGHPIPGQLEV
SGTKGSSKHTQWIAQEGVYFAAPITEHHD
Download sequence
Identical sequences A0A162ZCC5
XP_018283861.1.77709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]