SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A164ALC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A164ALC5
Domain Number 1 Region: 15-138
Classification Level Classification E-value
Superfamily YojJ-like 3.14e-30
Family YojJ-like 0.0029
Further Details:      
 
Domain Number 2 Region: 284-342
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000000126
Family NAD+-dependent DNA ligase, domain 3 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A164ALC5
Sequence length 353
Comment (tr|A0A164ALC5|A0A164ALC5_9BACI) Diadenylate cyclase {ECO:0000256|HAMAP-Rule:MF_01438} KW=Complete proteome OX=1817674 OS=Geobacillus sp. 8. GN=A3Q35_08715 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MKQEKSLKEILQFVAPGTPIREGIENVLRAKTGGLIVVGYNEKIKQIVDGGFYINCPFSP
AYLYELAKMDGAIILSDSGQKILYANAQLVPDTSIEVRETGMRHRTAERVAKQTGNLVIA
ISERRNVVTLYFGNSRYALRDIGVILTKANQALRTLEKYKSATDQSINNLGSLEFEDLVT
IDEVIQVLHRIEMVLRIKSEIINYIYELGTEGQLIQLQMTELLADIEKEAALLIKDYSME
RLNDPIPVLKQLQELSSSALLDDAVLLKLLGYPHFTNMNEPVVPRGYRFLHKIPKLPSVI
IENLVTTFENLKQIANATVEKLDEVEGIGEVRARKIKEGLRRLQDQYNIAREL
Download sequence
Identical sequences A0A164ALC5 A0A223E3H2
WP_066247900.1.101006 WP_066247900.1.2776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]