SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A164VI82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A164VI82
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-82
Family Capz beta-1 subunit 0.0000000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A164VI82
Sequence length 268
Comment (tr|A0A164VI82|A0A164VI82_9HOMO) F-actin capping protein beta subunit {ECO:0000313|EMBL:KZS94183.1} KW=Complete proteome; Reference proteome OX=1314777 OS=Sistotremastrum niveocremeum HHB9708. GN=SISNIDRAFT_453909 OC=Agaricomycetes; Trechisporales; Hydnodontaceae; Sistotremastrum.
Sequence
MGDVLDSMLDLMRRLPPTKIEENVAALTALCPDYADDFLGSVDQPLILKVDRTTGKEYLA
CDYNRDGDSYRSPWSNEYDPPIDDGTLPSAKMRKLEVAANEAFDTYRELYFEGGVSSVFL
WELEDGGFAGVVLLKKVLNPSTASEPSGSWDSIHVFEAVERGRNAHYKLTSTIMLQLVTR
SPGTGEVNLSGSMTRQSEMDAAVPDFSSHVPNTGRMIEDMEIKMRNLLQEVYFGKTRDVV
YDLRSVESLEYARRQRELQKELVGFMKR
Download sequence
Identical sequences A0A164VI82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]