SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A164ZHP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A164ZHP9
Domain Number 1 Region: 128-231
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.84e-24
Family Steroid-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A164ZHP9
Sequence length 270
Comment (tr|A0A164ZHP9|A0A164ZHP9_9HOMO) Cytochrome b5 {ECO:0000313|EMBL:KZS97724.1} KW=Complete proteome; Reference proteome OX=1314777 OS=Sistotremastrum niveocremeum HHB9708. GN=SISNIDRAFT_546785 OC=Agaricomycetes; Trechisporales; Hydnodontaceae; Sistotremastrum.
Sequence
MSWLSNVTGEPKKPYKVAKDEPRIADASGRLVVDKSANRPFLAHKEWREQEAARKKAKEE
RKKERLEKIARGEEVGPEEPEDDEEVGLIGLLKFIVYVLLFILLASKFVTGSWIWEYDGK
WTNIKSYIPADQRVFSPKMLAQFDGTDPDRPIYIAIDGVVYDVTAGAKTYGKGGSYNTMA
GVDATRSYGTGCFRDHRTHDLRGLTERELSGIQHWIDFFKNSNKYFKVGTVRLPPIDPNS
EIPKDCRAPKDEPEPEPQPAVGPKGKHNEL
Download sequence
Identical sequences A0A164ZHP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]