SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165BH33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165BH33
Domain Number 1 Region: 194-356
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.00000000106
Family (Pro)aerolysin, pore-forming lobe 0.015
Further Details:      
 
Domain Number 2 Region: 61-117
Classification Level Classification E-value
Superfamily Actin-crosslinking proteins 0.0000235
Family Fascin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165BH33
Sequence length 360
Comment (tr|A0A165BH33|A0A165BH33_9APHY) Uncharacterized protein {ECO:0000313|EMBL:KZT01042.1} KW=Complete proteome; Reference proteome OX=1314785 OS=Laetiporus sulphureus 93-53. GN=LAESUDRAFT_497095 OC=Agaricomycetes; Polyporales; Laetiporus.
Sequence
MYAGEDDNKQIVSSKRVPPPNEVENNAIAIIASNKAQPRPLGPACCYVNDKERRVLLPRY
LYAKDIYGRYLRVQKAATRWELLTIAATEPNADCIFESTRRDDGKYNFKGNNGHYFNHYS
FFSEDPDILTCDSTDSHGVPMRVVHESGDQVLLEHKQCWSSADKHTRGGVCLYPFIQSNS
RYNIVAAAVRKTSILDIEYNIANATVTNVPTVILDTVLENDTDAPVSRTVPFSYNRMVEG
TWNDDRGIMVGLGVTFVIGVPYVENEKLDIAVSPATQAHVWAGTEGVSATVGDEITVVVP
PRKKGIVEVVLRNARIKVPFKYKYKSEFLDDRIQLEERTGIYKNVDIYGIEVKMSNWEDL
Download sequence
Identical sequences A0A165BH33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]