SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A165CX22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A165CX22
Domain Number - Region: 69-108
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0017
Family Sigma4 domain 0.029
Further Details:      
 
Domain Number - Region: 5-47
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz beta-1 subunit 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165CX22
Sequence length 113
Comment (tr|A0A165CX22|A0A165CX22_STAEP) Packaging protein SaPI {ECO:0000313|EMBL:AMX28354.1} OX=1282 OS=Staphylococcus epidermidis. GN= OC=Staphylococcus.
Sequence
MFVGDKETLKDFILNYHNNVYDDYKDVSTNEFFTLNDDVEEYSYQTINADEHIFMNELDI
LVDRIADFREYNIFMFLCNGRTFNDIAQILEMSKTRVQQLFDGLLNKIIKQGA
Download sequence
Identical sequences A0A165CX22
WP_002457567.1.13046 WP_002457567.1.29011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]