SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165GF42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165GF42
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.92e-38
Family Ran-binding protein mog1p 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165GF42
Sequence length 184
Comment (tr|A0A165GF42|A0A165GF42_EXIGL) Mog1p/PsbP-like protein {ECO:0000313|EMBL:KZV90425.1} KW=Complete proteome; Reference proteome OX=1314781 OS=Exidia glandulosa HHB12029. GN=EXIGLDRAFT_677125 OC=Agaricomycetes; Auriculariales; Exidiaceae; Exidia.
Sequence
MELAKRDLFGGAMTVNLPRHNLVDASTLREVPDTQEVFLHTDCTASWIVEILQRVEPVDA
VEAAKFHFSSLAHDNDALSSQVVDVRTLPAQPNASPHAANTPPPTICDGWQEVAKYNRTA
PDKVEIMLAVYRLQAQNIDVVLSVNLPHVLADGTRTPEDLITGIKSSFVAVAQSLSIVDF
GLFA
Download sequence
Identical sequences A0A165GF42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]