SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A165K900 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A165K900
Domain Number - Region: 5-86
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0246
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A165K900
Sequence length 119
Comment (tr|A0A165K900|A0A165K900_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KZK70103.1} KW=Complete proteome OX=62322 OS=Shewanella baltica. GN=A1L58_14930 OC=Shewanellaceae; Shewanella.
Sequence
MTEINAALAGFIKNVKQHQTLWGLMDETGEGWVVCDSSEFEDTDVMPLWSSEATAKSHCS
DEWHDYQPVAISLEEFLEYWVSDLNDDGVLIGVDWQTDEDCLELDPIVLAKDLVDVEEV
Download sequence
Identical sequences A0A165K900 A3D5S2 B8E6Y6 G0AV62
gi|126174805|ref|YP_001050954.1| gi|386324202|ref|YP_006020319.1| gi|217972931|ref|YP_002357682.1| 325240.Sbal_2592 407976.Sbal223_1754 gi|386341559|ref|YP_006037925.1| WP_006082098.1.19221 WP_006082098.1.24904 WP_006082098.1.35668 WP_006082098.1.35710 WP_006082098.1.74325 WP_006082098.1.8014 WP_006082098.1.86146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]