SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165RY72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165RY72
Domain Number 1 Region: 83-158
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.06e-31
Family Skp1 dimerisation domain-like 0.0000283
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily POZ domain 8.37e-22
Family BTB/POZ domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165RY72
Sequence length 161
Comment (tr|A0A165RY72|A0A165RY72_9APHY) S-phase kinase-associated protein 1A-like protein {ECO:0000313|EMBL:KZT71298.1} KW=Complete proteome; Reference proteome OX=1314783 OS=Daedalea quercina L-15889. GN=DAEQUDRAFT_687768 OC=Agaricomycetes; Polyporales; Daedalea.
Sequence
MVLLVTSDNEQFVVDKEVAERSVLIKNMLEDVGESDQPIPLPNVSSSVLKKVLEYCEHHR
GEPLPTAESEQSQDENRKRTTDISEWDQKFITVDQEMLFEIILAANYLDIKPLLDVGCKT
VANMIKGKTPEEIRKLFNIVNDFTPEEEAQIKKENEWAEDR
Download sequence
Identical sequences A0A165RY72 S8DKN2
jgi|Fompi3|1026577|fgenesh1_kg.162_#_7_#_isotig03225 jgi|Fompi1|159572|estExt_fgenesh1_kg.C_80126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]