SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A165VFA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A165VFA6
Domain Number 1 Region: 5-286
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-83
Family Capz beta-1 subunit 0.0000000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165VFA6
Sequence length 289
Comment (tr|A0A165VFA6|A0A165VFA6_9HOMO) F-actin capping protein, beta subunit {ECO:0000313|EMBL:KZT29594.1} KW=Complete proteome; Reference proteome OX=1314782 OS=Neolentinus lepideus HHB14362 ss-1. GN=NEOLEDRAFT_1238401 OC=Agaricomycetes; Gloeophyllales; Gloeophyllaceae; Neolentinus.
Sequence
MTDLVDSMLDLMRRLPPTRVEENVTALVNICPDYADDLLGSVDQPLKLKTDRATGREYLA
CDYNRDGESYRSPWSNEYDPPLDDGTVPTPKLRQLEIKANEAFDTYREMYFEGGVSSVFL
WDLDDGGFAGVVLFKKSLSPSASSEPSGSWDSIHVFEAAERGRQAHYKLTSTIMLELVTH
SDNGANTAYKKPNSDSPTMDGIKTNGDVSLSGSMTRQTEQDCPVQNQESHITNMGRMIEE
MEIKMRNLLQEVYFGKTRDVVYDLRSIESLERQRRQRELQKELVGFMKR
Download sequence
Identical sequences A0A165VFA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]