SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A165X7B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A165X7B6
Domain Number - Region: 131-203
Classification Level Classification E-value
Superfamily Lipocalins 0.00316
Family Retinol binding protein-like 0.01
Further Details:      
 
Domain Number - Region: 30-122
Classification Level Classification E-value
Superfamily BEACH domain 0.0314
Family BEACH domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A165X7B6
Sequence length 312
Comment (tr|A0A165X7B6|A0A165X7B6_MIMIV) Uncharacterized protein {ECO:0000313|EMBL:AMZ02520.1} OX=1835008 OS=Mimivirus Bombay. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MLSSYCNPNEPIPREIPSLKAHIFEYMYQYRNWSKFVGDVKKNHGSIDDLEFTITEFKHV
HYMNVARVIVHGVEKFNKCCDNINNNDINLDCELTKNIQKHFQGCSEKIPQIYIYGNFCR
SIVSGQLYDNINIMFHDDKCSEMFRQFCIPKNYICRNLQWNWSKGNVRGIDYELNFKGYN
DYKVHLFLSWCNDMNIVPDNIYFDVDSLYSTISHENIHFMSSLKSLYPDCNVDKIIKNCT
NNKFILLDNTKSPTITHPQPFVFSRNIHLKCINVNKEQHIKFLFLKMKSKGWKCLNEDCE
TPWCILQKDLLH
Download sequence
Identical sequences A0A0G2Y828 A0A0U2TZQ3 A0A165X7B6 A0A1E1ESB9 E3VY57 G8ECC1 J2YC21 Q5UPE6 W6GGS1
YR069_MIMIV YP_003986559.1.55212 gi|311977440|ref|YP_003986559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]