SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A166BT50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A166BT50
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.04e-80
Family LplA-like 0.00000115
Further Details:      
 
Domain Number 2 Region: 243-329
Classification Level Classification E-value
Superfamily SufE/NifU 5.75e-29
Family SP1160 C-terminal domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A166BT50
Sequence length 329
Comment (tr|A0A166BT50|A0A166BT50_BACBA) Lipoate--protein ligase {ECO:0000256|SAAS:SAAS00603724} KW=Complete proteome OX=1455 OS=Bacillus badius. GN=A4244_13045 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLFIDNQGITDPRVNLAIEEYAVKYLDINESYLLFYINEPSIIIGKNQNTIEEINVDYVE
EKGIHVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFHNFKKFTGPVVEALHKLGIQAEMS
GRNDILANGLKISGNAQFSTKGRMFSHGTLMFQTNMDDVVAALKVRKDKIESKGIKSIRS
RVTNIADLLETPMTIEEFRQFLLKNIFAGEDEIPEYRLDDKDWKVIEQISQERYKSWDWN
YGKSPAFNIQRSHRFPVGLIDARLDVKNGLIKSCKIYGDFFGVGDVEEIENGLQGVKYEK
SAIKQALASLDVPHYFGKVTKDELVDLLY
Download sequence
Identical sequences A0A166BT50
WP_063383907.1.65384 WP_063383907.1.73330 WP_063383907.1.87680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]