SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A166VN98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A166VN98
Domain Number 1 Region: 13-283
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-82
Family Capz beta-1 subunit 0.0000000813
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A166VN98
Sequence length 286
Comment (tr|A0A166VN98|A0A166VN98_9PEZI) F-actin capping protein beta subunit {ECO:0000313|EMBL:KZL74769.1} KW=Complete proteome; Reference proteome OX=708197 OS=Colletotrichum tofieldiae. GN=CT0861_07892 OC=Colletotrichum.
Sequence
MQEVLSNASLSPSSDLLRRLNPKHTTDHLNAIISLAPDLTEDLLSSVDQPLTVKRCKQTG
RDYLLCDYNRDGDSYRSPWSNQFDPPLDEAGAGGVGAGGSEGAGEGAIPSERVRKMEVRA
NEAFDVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSATPGGSAEGVWDSIHVFEAIERG
RTTQYKLTSTVILSLSTSTGALGDMDLSGNMTRQVEQELPVEGDESHIANVGRLVEDMEL
KMRNLLQEVYFGKAKDVVGDLRSIGSLSEGAKDRAAQREIIGSMQR
Download sequence
Identical sequences A0A166VN98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]