SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A167DVK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167DVK6
Domain Number 1 Region: 5-301
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-80
Family Capz beta-1 subunit 0.0000000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A167DVK6
Sequence length 303
Comment (tr|A0A167DVK6|A0A167DVK6_9HYPO) WASH complex, F-actin capping protein, beta subunit {ECO:0000313|EMBL:OAA42941.1} KW=Complete proteome OX=1081107 OS=Cordyceps brongniartii RCEF 3172. GN=BBO_04856 OC=Cordyceps; Cordyceps brongniartii.
Sequence
MAEVDPFDSALDLLRRLNPKHTSEHLAAIISLAPDLTEDLLSSVDQPLTVRRCKQTGRDY
LLCDYNRDGDSYRSPWSNQFDPPLDGAAAGGGGGGGGTGGVGPGGSEGAGEGAIPSERVR
KMEVKANEAFDVYRELYYEGGVSSVYFWNLDDGFAGVVLLKKSSPPGGSSDGVWDSIHVF
EAIERGRTTHYKLTSTVILSLATASPSSSTTTTTTTPLGGDLDLSGNMTRQVEQDLPVDA
DESHIANVGRLVEDMELKMRNLLQEVYFGKARDVVGDLRSAGSLSDGARDRETQREIIGS
MRR
Download sequence
Identical sequences A0A167DVK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]