SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A167K566 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167K566
Domain Number 1 Region: 16-120
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.71e-26
Family Steroid-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A167K566
Sequence length 129
Comment (tr|A0A167K566|A0A167K566_9BASI) Progesterone binding protein {ECO:0000313|EMBL:KZO94267.1} KW=Complete proteome; Reference proteome OX=1330018 OS=Calocera viscosa TUFC12733. GN=CALVIDRAFT_228933 OC=Dacrymycetes; Dacrymycetales; Dacrymycetaceae; Calocera.
Sequence
MAAPNPSFMSAPTAALPPPGNKQFRHADLKSFDGTAAGKPIYVSIKGTVFDVSSRADSYG
PSGSYHIFAGKDASKGLGSSSLKPEDASYDWSGLDDKSKKVLNDWYGFFEKRYPVVGYVA
DIPTNLRAK
Download sequence
Identical sequences A0A167K566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]