SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A167UYK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A167UYK8
Domain Number 1 Region: 8-204
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.62e-62
Family Capz beta-1 subunit 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A167UYK8
Sequence length 206
Comment (tr|A0A167UYK8|A0A167UYK8_9EURO) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KZZ86781.1} OX=392613 OS=Ascosphaera apis ARSEF 7405. GN=AAP_06251 OC=Eurotiomycetidae; Onygenales; Ascosphaeraceae; Ascosphaera.
Sequence
MADVQLDSALYRIPWSNEFDPPLDDGTVPSERVRKLEVAANEAFDVYRELYYEGGVSSVY
FWDLEDGFAGVVLLKKGITPGSKNSGMWDSIHVFEATDRARTCHYKLTSTVILHLSTGNQ
ALGDMDLSGNMTRQLEETMAVDGDMSHVANVGRLVEDMEFKMRNLLQEVYFGKAKDIVAD
LRSTTPLSQASKDQAAHRDVINAMKG
Download sequence
Identical sequences A0A167UYK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]