SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A168JEM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A168JEM2
Domain Number 1 Region: 45-123
Classification Level Classification E-value
Superfamily YdhA-like 2.22e-23
Family YdhA-like 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A168JEM2
Sequence length 126
Comment (tr|A0A168JEM2|A0A168JEM2_KLEOX) Lysozyme inhibitor {ECO:0000313|EMBL:SAQ10365.1} KW=Complete proteome OX=571 OS=Klebsiella oxytoca. GN=SAMEA2273876_04985 OC=Enterobacteriaceae; Klebsiella.
Sequence
MKLTGGDLPSWTGIVEGKRMKKILIALVPFMLAGCSYYNQFVERMQTDTLEYQCDQKPLT
VHINNTRQIASFIYDNQQLNLAQGLSASGARYTDGVYVFWSKGDSATVYKRDRVVLENCQ
LQTAKR
Download sequence
Identical sequences A0A168JEM2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]