SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A170U170 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A170U170
Domain Number 1 Region: 85-151
Classification Level Classification E-value
Superfamily BEACH domain 1.7e-29
Family BEACH domain 0.00014
Further Details:      
 
Domain Number 2 Region: 4-56
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-16
Family PreBEACH PH-like domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A170U170
Sequence length 151
Comment (tr|A0A170U170|A0A170U170_TRIIF) Wd repeat and fyve domain-containing protein 3 {ECO:0000313|EMBL:JAR95511.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
KRQCSKFNYEDIREVHKRRYLLQPMALEVFSGDGRNYLLAFPRKIRNKVYQRFMAFATGI
ADSAQQSVAGQKRTANVEQGASLLSSLIGETSVTQRWVRGELTNFQYLMHLNTLAGRSYN
DLMQYPVFPWILADYESEQLDLMDPAVFRDF
Download sequence
Identical sequences A0A170U170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]